PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 191aa    MW: 21449.1 Da    PI: 6.5112
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22310.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS182.53.1e-562179189374
       GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                l++e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a++ +eseer++vE++
  PK22310.1   2 LDPERLNVSKREAVAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGASYDEESEERHVVEQQ 94 
                899****************9..999999999999....**********************.899************************************ PP

       GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                ll+rei+nv+a  g + r r  ++++Wre+l+++GF+ ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaWr
  PK22310.1  95 LLSREIRNVLAVGGPS-RSRDVKFHNWREKLQQSGFRGISLAGNAATQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWR 179
                ***************9.667778**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098524.1831159IPR005202Transcription factor GRAS
PfamPF035141.1E-532179IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
NLDPERLNVS KREAVAVHWL QHSLYDVTGS DTNTLWLLQR LAPKVVTVVE QDLSHAGSFL  60
GRFVEAIHYY SALFDSLGAS YDEESEERHV VEQQLLSREI RNVLAVGGPS RSRDVKFHNW  120
REKLQQSGFR GISLAGNAAT QATLLLGMFP SDGYTLVEDN GTLKLGWKDL CLLTASAWRP  180
PYHATPTTLH Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-169179197375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113028.11e-126hypothetical protein L484_022753
SwissprotQ9AVK41e-120SCR_PEA; Protein SCARECROW
TrEMBLW9SCD51e-126W9SCD5_9R
STRINGPOPTR_0016s15060.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-115GRAS family protein